Protein coding transcript 32738

• Transcript: Ll_transcript_311982
• CDS coordinates: 237-686 (+)
• Peptide sequence: MKWVYAQSDGGDGKRVKTTGDNRNESGKGETETSSGKHEEQKQTTPEPHPKQDYIHVRARRGQATDSHSLAERARREKISERMKILQDLVPGCNKVIGKALVLDEIINYIQSLQRQVEFLSMKLEAVNSRLTPSMEVFPPKDVSIKQHP*
• ORF Type: complete

Annotations of Ll_transcript_311982

• Blastp: Transcription factor BPE from Arabidopsis with 66.01% of identity
• Blastx: Transcription factor BPE from Arabidopsis with 66.01% of identity
• Eggnog: Transcription factor(ENOG410YAFX)
• Kegg: Link to kegg annotations (AT1G59640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445530.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;