Protein coding transcript 32740

• Transcript: Ll_transcript_311985
• CDS coordinates: 98-634 (+)
• Peptide sequence: MKSDGGDGKRVKTTGDNRNESGKGETETSSGKHEEQKQTTPEPHPKQDYIHVRARRGQATDSHSLAERARREKISERMKILQDLVPGCNKVIGKALVLDEIINYIQSLQRQVEFLSMKLEAVNSRMTPGIEVFPHKDFDQQTFDTSVMPFASQATREYSRGSSPEWLHMQVGGFERTK*
• ORF Type: complete

Annotations of Ll_transcript_311985

• Blastp: Transcription factor BHLH094 from Oryza sativa with 66.3% of identity
• Blastx: Transcription factor BHLH094 from Oryza sativa with 66.3% of identity
• Eggnog: Transcription factor(ENOG410YAFX)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445529.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;