Protein coding transcript 32743

• Transcript: Ll_transcript_311987
• CDS coordinates: 98-592 (+)
• Peptide sequence: MKSDGGDGKRVKTTGDNRNESGKGETETSSGKHEEQKQTTPEPHPKQDYIHVRARRGQATDSHSLAERARREKISERMKILQDLVPGCNKVIGKALVLDEIINYIQSLQRQVEFLSMKLEAVNSRLTPSMEVFPPKDAPRKFLVESSMASFLEKQEMLVDAFQD*
• ORF Type: complete

Annotations of Ll_transcript_311987

• Blastp: Transcription factor BPE from Arabidopsis with 69.5% of identity
• Blastx: Transcription factor BPE from Arabidopsis with 58.33% of identity
• Eggnog: Transcription factor(ENOG410YAFX)
• Kegg: Link to kegg annotations (AT1G59640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422701.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;