Protein coding transcript 32747

• Transcript: Ll_transcript_311992
• CDS coordinates: 380-1237 (+)
• Peptide sequence: MDPLPMINDTSFSNGGPTNTTPFHLSEIWQFPATGVSGISDNGLGLRTSSFGHGLGQFGDFGPTRHVSGNDPINLERRAIILNKKRRDSEEESAKVVSTSNGGGISAMSDGGDRKRVKTTGSNINESGKGETETSSGKHAEQEQTTPEPPLKQDYIHVRARRGQATDSHSLAERARREKISERMKILQDLVPGCNKVIGKALVLDEIINYIQSLQRQVEFLSMKLEAVNSRLTPSMEVFPPKDFNQQTFDTVGMPFTSQASRDYSRGSSPVWLHMQVGGGFERPT*
• ORF Type: complete

Annotations of Ll_transcript_311992

• Blastp: Transcription factor BHLH094 from Oryza sativa with 60.98% of identity
• Blastx: Transcription factor BHLH094 from Oryza sativa with 60.98% of identity
• Eggnog: Transcription factor(ENOG410YAFX)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445528.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;