Protein coding transcript 328

• Transcript: Ll_transcript_465622
• CDS coordinates: 1-447 (+)
• Peptide sequence: LQHLSATTTFLTKKMSIIPGSNNPFENSLSFPTPLSSQNPAFLNNQIDWNETPEAHIFKADMSGMNKEEVKVEVEEGRVLQISGERSMKIEDKNDACHRVECSSGRFKRSFTLPANAKMDQVKASVENGVLTVTVPKEDIKKAIENSH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_465622

• Blastp: 17.3 kDa class I heat shock protein from Soja with 65% of identity
• Blastx: 17.3 kDa class I heat shock protein from Soja with 65% of identity
• Eggnog: response to heat(COG0071)
• Kegg: Link to kegg annotations (100526870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425324.1)
• Pfam: Hsp20/alpha crystallin family (PF00011.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;