Protein coding transcript 3281

• Transcript: Ll_transcript_452048
• CDS coordinates: 200-1000 (+)
• Peptide sequence: MGTKSLCYVFLLYAFLVQFNLHNCAIVSQDIARSESEALEQAGSKRETLEIIIGGGSYTPAPSPQCPPPPPPPCPPPPQPLSRLDKARLVLLNFTKFIDDPKGYTKNWNQNTINTCKFNGIRCAPYPNTTEQAVAGIDLNQAGISCLNKTPLSLYGILDRIPELTFFHVNSNNFSGGIPNQITKFPFFFELDVSNNKLVGEFPKEVLQAMQLVFLDLRFNYLYGSLPPQLFQLPLDFIFINNNKFSQCLPDNFGSTPARYSTMDIP*
• ORF Type: complete

Annotations of Ll_transcript_452048

• Blastp: Leucine-rich repeat extensin-like protein 1 from Arabidopsis with 41.01% of identity
• Blastx: Uncharacterized protein At4g06744 from Arabidopsis with 57.99% of identity
• Eggnog: Leucine-rich repeat(ENOG411157W)
• Kegg: Link to kegg annotations (AT1G12040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445810.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;