Transcript | Ll_transcript_313295 |
---|---|
CDS coordinates | 1183-1899 (+) |
Peptide sequence | MMEAKVGKDVSATNLTLIPDNLEDPVGVPPEWTPPNVSVPILNLVDNIFQLKKRGWLRRQVFWISKQILQLVMEDAIDDWLLREIHWLRREDTIAQGIRWIQDIFWPGGTFFVRLRAPQVLSGGSGFDQKPSQTLSESGGIKMAKSGSGSFEQQLEAARRASDLKKLLFDGAPAALVSLIGQKQYRRCASDIYYFSQSSICVKQLAYAIFELLLISIFPEMRNVVMSVHENMHVHQPV* |
ORF Type | complete |
Blastp | Sorting nexin-13 from Mus with 21.2% of identity |
---|---|
Blastx | Sorting nexin-13 from Mus with 21.54% of identity |
Eggnog | Sorting nexin 13(ENOG410XRJ0) |
Kegg | Link to kegg annotations (217463) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420523.1) |
Pfam | Sorting nexin C terminal (PF08628.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer