Protein coding transcript 32827

• Transcript: Ll_transcript_313294
• CDS coordinates: 352-1188 (+)
• Peptide sequence: MKAMETVYDLIDEVKVRTLWWFLCIFAVSYFLTNTSKSMWMNAPIAILFVSALRIIFNTVEFRWKVQQPRTQTYLSHLEKKQLSPKDPRLSSSPTPAKWKRKINSPVVEAAMSDFIGMILKDFVVDLWYSEITPDRDFPEHIHEIIMDVLAEISGRVEEINLVDLLTRDIVDLVGDHLELFRRNQAAIGVDVMKTLSSEERDARLKFHLLNSKELHPALISPESEYKVLQRLMSAVLATVLRQREAQCPVIRSIARELLTCLVMQPIMNLASPGYVAK*
• ORF Type: complete

Annotations of Ll_transcript_313294

• Blastp: Sorting nexin-13 from Mus with 24.46% of identity
• Blastx: Sorting nexin-13 from Mus with 24.46% of identity
• Eggnog: Sorting nexin 13(ENOG410XRJ0)
• Kegg: Link to kegg annotations (217463)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445759.1)
• Pfam: PXA domain (PF02194.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;