Protein coding transcript 32863

• Transcript: Ll_transcript_312561
• CDS coordinates: 376-885 (+)
• Peptide sequence: MQFKLNKRVTRVTRWIFIRFFSTRPGYRRMGSSSSSRKPMTKKLISLGRKITIRARSLCSSSKFGSRYGPIGSDPVEDTVPKGHLAVYVGQKDGDGEFCRVLVPVIYFNHPLFGELLNKAEKVNGFEHQGGITIPCRVAEFERVKTRIESGFGVNSGGCRRLALPWFGK*
• ORF Type: complete

Annotations of Ll_transcript_312561

• Blastp: Auxin-responsive protein SAUR36 from Arabidopsis with 52.08% of identity
• Blastx: Auxin-responsive protein SAUR36 from Arabidopsis with 49.68% of identity
• Eggnog: auxiN-responsive(ENOG410YVYP)
• Kegg: Link to kegg annotations (AT2G45210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435417.1)
• Pfam: Auxin responsive protein (PF02519.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;