Protein coding transcript 32888

• Transcript: Ll_transcript_314290
• CDS coordinates: 117-530 (+)
• Peptide sequence: MAGKGGKGLLAAKTTAAANKDKDKDKKRPISRSSRAGIQFPVGRIHRQLKQRVSAHGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTSKE*
• ORF Type: complete

Annotations of Ll_transcript_314290

• Blastp: Histone H2A variant 1 from Arabidopsis with 94.16% of identity
• Blastx: Histone H2A variant 1 from Arabidopsis with 96.33% of identity
• Eggnog: histone h2a(COG5262)
• Kegg: Link to kegg annotations (AT3G54560)
• CantataDB: Link to cantataDB annotations (CNT0001879)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441900.1)
• Pfam: Core histone H2A/H2B/H3/H4 (PF00125.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;