Transcript | Ll_transcript_314291 |
---|---|
CDS coordinates | 109-525 (+) |
Peptide sequence | MGGKGGKGLLAAKTTAAAAYKDKDKDKKRPTSRSSRAGIQFPVGRIHRQLKQRVQANGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKE* |
ORF Type | complete |
Blastp | Probable histone H2A variant 3 from Oryza sativa with 89.13% of identity |
---|---|
Blastx | Probable histone H2A variant 3 from Oryza sativa with 93.58% of identity |
Eggnog | histone h2a(COG5262) |
Kegg | Link to kegg annotations (4334071) |
CantataDB | - |
Mirbase | ath-MIR841b (MI0014669) |
Ncbi protein | Link to NCBI protein (XP_004495152.1) |
Pfam | Core histone H2A/H2B/H3/H4 (PF00125.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer