| Transcript | Ll_transcript_372587 |
|---|---|
| CDS coordinates | 1487-1798 (+) |
| Peptide sequence | MTEYFQTTYKFLDLSPHALIPMHGRINLWPKQMLCGYLKNRRSREANILKAIEGGAKTLFDTVAYVYADVDRSAWIPASSNVRLHVAHLAQQHKLPKVITNKL* |
| ORF Type | complete |
| Blastp | Beta-lactamase-like protein 2 homolog from Sophophora with 30.21% of identity |
|---|---|
| Blastx | - |
| Eggnog | Beta-lactamase domain protein(COG0491) |
| Kegg | Link to kegg annotations (Dmel_CG12375) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019441412.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer