Protein coding transcript 32949

• Transcript: Ll_transcript_371025
• CDS coordinates: 565-1689 (+)
• Peptide sequence: MPEIRNHPPNQKKTVFKKLKHKANSFEDSKLKRKLRIIWHDPDATDSSSDEEGGDQEMRRKAKRTVLEVALPPFPPNPVIADTSTESSSNTELNKKRVLAKTPPVKRKTAGKCRGIRMRKWGKWAAEIRDPFKGRRLWLGTYNTAEEASQAYEMKRLEFETMAKAMSGEKSKNNNADVVVGFSAQAMVTQEQSNFNYSDSSGAASASESKSAATLDDSECVLSPASPSSVLELDNSASKPSNLVEDGKVSTNEAVEKNCLEAEFAQLIGNIDESGEINDLEAELADLEMPDLSIFAVPPPTNDAAAAAADAAPSAFEFDWLTFDFDDDLVGLEDIHIGGIDEDGPSELPDFDFDNFSADEFAGWIEEPLNIPCI*
• ORF Type: complete

Annotations of Ll_transcript_371025

• Blastp: Ethylene-responsive transcription factor ERF118 from Arabidopsis with 32.29% of identity
• Blastx: Ethylene-responsive transcription factor ERF118 from Arabidopsis with 46.97% of identity
• Eggnog: Transcription factor(ENOG410Z04J)
• Kegg: Link to kegg annotations (AT1G68550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457008.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;