Protein coding transcript 32966

• Transcript: Ll_transcript_371835
• CDS coordinates: 417-860 (+)
• Peptide sequence: MIFVTMFMLRSDCLDYDVLIRLKRKGAGSGNKKSKKAAKDPNKPKRPPSAFFVFMSEFREQYKKDFPENKSVANVSKAGGSKWKSMSDAEKAPYVARAEKKKEEYGRTIEAYNRKLEGKNPSEEDESDKSKSEVHDDDEDEEEDDDE*
• ORF Type: complete

Annotations of Ll_transcript_371835

• Blastp: High mobility group B protein 2 from Arabidopsis with 67.57% of identity
• Blastx: HMG1/2-like protein from Vicia with 72.22% of identity
• Eggnog: high mobility group(COG5648)
• Kegg: Link to kegg annotations (AT1G20693)
• CantataDB: Link to cantataDB annotations (CNT0002562)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446905.1)
• Pfam: HMG-box domain (PF09011.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;