Transcript | Ll_transcript_372979 |
---|---|
CDS coordinates | 822-1334 (+) |
Peptide sequence | MKFHGFFKLPTFSLHSSLLTDRVTISFILAGASCVINALCYAELASRFPAVVGGAYLYAYSAFNELTAFLVFAQLMLDYHIGAASIARSLASYIVNILELFPIFKDNIPNWIGHGENIGDVLSINVLAPVLLMLLTLILCRGVEESSAVNSLMTITKVHFYLTSYHYMVV* |
ORF Type | complete |
Blastp | Cationic amino acid transporter 9, chloroplastic from Arabidopsis with 75.91% of identity |
---|---|
Blastx | Cationic amino acid transporter 9, chloroplastic from Arabidopsis with 76.64% of identity |
Eggnog | amino acid(COG0531) |
Kegg | Link to kegg annotations (AT1G05940) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461736.1) |
Pfam | Amino acid permease (PF13520.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer