Protein coding transcript 33012

• Transcript: Ll_transcript_372980
• CDS coordinates: 989-1834 (+)
• Peptide sequence: MVCFCNAGVTISFILAGASCVINALCYAELASRFPAVVGGAYLYAYSAFNELTAFLVFAQLMLDYHIGAASIARSLASYIVNILELFPIFKDNIPNWIGHGENIGDVLSINVLAPVLLMLLTLILCRGVEESSAVNSLMTITKVVIVIIVIFAGAFEVDVSNWSPFVPNGMGSVFTGATVVFFAYVGFDAVANSAEESKRPQRDLPIGIIGSLVICIALYIGVCLVITGMVPYTFLGEDAPLAEAFESKGLKFVSILISVGAVAGLTTTLLVGLYVQVIHF*
• ORF Type: complete

Annotations of Ll_transcript_372980

• Blastp: Cationic amino acid transporter 9, chloroplastic from Arabidopsis with 78.97% of identity
• Blastx: Cationic amino acid transporter 9, chloroplastic from Arabidopsis with 79.34% of identity
• Eggnog: amino acid(COG0531)
• Kegg: Link to kegg annotations (AT1G05940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461736.1)
• Pfam: Amino acid permease (PF00324.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;