Protein coding transcript 33014

• Transcript: Ll_transcript_372982
• CDS coordinates: 49-405 (+)
• Peptide sequence: MGRGEHNRSSSSSSSSVFSHFFSSALRTKRLLSPSEKSAVDGSDHGLSRRLGVFDLILLGIGASIGAGIFVVTGTVARDVGPGISQFNHFNLFDIAEFDCCHVLIYYCSYFKLSVILA*
• ORF Type: complete

Annotations of Ll_transcript_372982

• Blastp: Cationic amino acid transporter 9, chloroplastic from Arabidopsis with 60.47% of identity
• Blastx: Cationic amino acid transporter 9, chloroplastic from Arabidopsis with 67.74% of identity
• Eggnog: amino acid(COG0531)
• Kegg: Link to kegg annotations (AT1G05940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461736.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;