Protein coding transcript 33027

• Transcript: Ll_transcript_372986
• CDS coordinates: 225-1082 (+)
• Peptide sequence: MGEEAKITDYSRDSERVTEWEIGLPTDNDITPLSQPLIPPELASAFSISPESYRTLVEVNRASNDTISAIRGGGGGSQAFSTVVEPDEEEEEEPDRENGSGTESRKLRRLDSAEDADSVMLNNDDSSARALKRPRLVWTPQLHKRFVDVVAHLGIQNAVPKTIMQLMNVEGLTRENVASHLQKYRLYLKRMQGFSDNAPSSTDQLFASTPVPQSLQDSSAGGCDGGSAGHAPIPMPYPPPPPHMMGMFGIPHHGFSNGGFQQRDWSSGFSYPQPHTNGLTPSGDK*
• ORF Type: complete

Annotations of Ll_transcript_372986

• Blastp: Transcription factor LUX from Arabidopsis with 52.6% of identity
• Blastx: Transcription factor LUX from Arabidopsis with 56.84% of identity
• Eggnog: Myb family transcription factor(ENOG410XXJ3)
• Kegg: Link to kegg annotations (AT3G46640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458894.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;