Protein coding transcript 33077

• Transcript: Ll_transcript_372775
• CDS coordinates: 2667-3314 (+)
• Peptide sequence: MTQHYGAIQGLAALGPNVVRLLLLPNLEPYMRLLEPEMLLEKQKNEMKRQEAWRVYGALLRAAGQCIYDRLKLFHNFPSPLPHAFWKTNARILTSTYKRKASLERLEERPPLKKTTTDGDGDVVMTNSEPVEEAGTRASAVDPASSSSEQTKSETTLDGTVRGNRDDTLAMKTSAALAQVWKDELDSGRILVSLFELFGEGILSFIPAPEMYMFL*
• ORF Type: complete

Annotations of Ll_transcript_372775

• Blastp: Transcription initiation factor TFIID subunit 6 from Arabidopsis with 49.57% of identity
• Blastx: Transcription initiation factor TFIID subunit 6 from Arabidopsis with 74.03% of identity
• Eggnog: Transcription initiation factor TFIID(COG5095)
• Kegg: Link to kegg annotations (AT1G04950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452094.1)
• Pfam: TAF6 C-terminal HEAT repeat domain (PF07571.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;