Transcript | Ll_transcript_372765 |
---|---|
CDS coordinates | 324-1157 (+) |
Peptide sequence | MSIVPKETIEVIAQSIGINNFSPDVALALAPDVEYRIREIMQEAIKCMHHSKRTTLTADDVDGALNMRNVEPIYGFTSGGPLRFKRAAGHRDLFYIDDKDVDLKDVIEASLPKAPLATAITCHWLAIEGVQPAIPENAPVAVISAPADVKKEEQKNDNLPVDIKLPVKHVLSRELQLYFDKVTELALSASDSVLFKEALVSLATDSGLHPLVPYFTCFIADEVSRGLNNFPLLFALMRVVNSLLQNPHIHIEPYVSSLLVWFGILVDILADIIMIFV* |
ORF Type | complete |
Blastp | Transcription initiation factor TFIID subunit 6 from Arabidopsis with 76.83% of identity |
---|---|
Blastx | Transcription initiation factor TFIID subunit 6 from Arabidopsis with 76.83% of identity |
Eggnog | Transcription initiation factor TFIID(COG5095) |
Kegg | Link to kegg annotations (AT1G04950) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452094.1) |
Pfam | TATA box binding protein associated factor (TAF) (PF02969.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer