Transcript | Ll_transcript_370600 |
---|---|
CDS coordinates | 138-788 (+) |
Peptide sequence | MTTTNTMQYKNLGRSGLRVSQLSYGAWVSFGNQLDVKEAKSLMQCCRDHGVNFFDNAEVYANGRAEEIMGQAIRELGWKRSDLVVSTKIFWGGQGPNDKGLSRKHIIEGTKASLKRLDMEYVDVIYCHRPDTTTPIEETVRAMNYVIDNGWAFYWGTSEWTAQQITEAWSVAQRLDLIGPIVEQPEYNLLSRHKVGFIVVVSFIWVIRVGKVLFFI* |
ORF Type | complete |
Blastp | Probable voltage-gated potassium channel subunit beta from Arabidopsis with 86.77% of identity |
---|---|
Blastx | Probable voltage-gated potassium channel subunit beta from Arabidopsis with 86.77% of identity |
Eggnog | Aldo keto reductase(COG0667) |
Kegg | Link to kegg annotations (AT1G04690) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432797.1) |
Pfam | Aldo/keto reductase family (PF00248.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer