Protein coding transcript 33177

• Transcript: Ll_transcript_371986
• CDS coordinates: 123-920 (+)
• Peptide sequence: MASHLHNPMPLPPINDLTCIVTGSTSGIGLEIARQLAQAGAHVVMAVRNTKAAQELIQKWSVDSAGLGIALNVEVMGVDLLSLDSVARFAEAWNARSAPLHVLINNAGIFSIGEPQKFSKDGYEEHLQVNHLAPALLSVLLLPSLIRGSPSRIVNVNSIMHHVGFVDAEDMNITSGKRKFSSLMGYSNSKLAQVMFSSVLNKRLPAESGINVLCVSPGIVQTNVARDLPKIVQSTYRLVPYFIFNAQEGLFYHFFMIEILTVFSF*
• ORF Type: complete

Annotations of Ll_transcript_371986

• Blastp: Retinol dehydrogenase 12 from Homo with 36.52% of identity
• Blastx: Retinol dehydrogenase 12 from Homo with 36.52% of identity
• Eggnog: Dehydrogenase reductase(COG1028)
• Kegg: Link to kegg annotations (145226)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458836.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;