Transcript | Ll_transcript_371989 |
---|---|
CDS coordinates | 1321-1881 (+) |
Peptide sequence | MHHVGFVDAEDMNLTSGKRKYSSVIGYSNSKLAQVMFSSVLHKRLPGESGVSVLCVSPGIVQTNVARDLPKYLQAGYRLIPYFIFNAQEGSRSTLFAATDPQISEYCELLKADEWPVCAFISQECRPANPSEEAHNLQTSYEVWEKTLEMIGLPSDAVEKLIEGEDVKCRYGQEQKSKNDDSRKLD* |
ORF Type | complete |
Blastp | Retinol dehydrogenase 11 from Homo with 28.39% of identity |
---|---|
Blastx | WW domain-containing oxidoreductase from Homo with 45.71% of identity |
Eggnog | Dehydrogenase reductase(COG1028) |
Kegg | Link to kegg annotations (51109) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431398.1) |
Pfam | short chain dehydrogenase (PF00106.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer