Protein coding transcript 33178

• Transcript: Ll_transcript_371989
• CDS coordinates: 1321-1881 (+)
• Peptide sequence: MHHVGFVDAEDMNLTSGKRKYSSVIGYSNSKLAQVMFSSVLHKRLPGESGVSVLCVSPGIVQTNVARDLPKYLQAGYRLIPYFIFNAQEGSRSTLFAATDPQISEYCELLKADEWPVCAFISQECRPANPSEEAHNLQTSYEVWEKTLEMIGLPSDAVEKLIEGEDVKCRYGQEQKSKNDDSRKLD*
• ORF Type: complete

Annotations of Ll_transcript_371989

• Blastp: Retinol dehydrogenase 11 from Homo with 28.39% of identity
• Blastx: WW domain-containing oxidoreductase from Homo with 45.71% of identity
• Eggnog: Dehydrogenase reductase(COG1028)
• Kegg: Link to kegg annotations (51109)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431398.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;