Transcript | Ll_transcript_451960 |
---|---|
CDS coordinates | 3-374 (+) |
Peptide sequence | TKISNKMAGQFRILEYSLIIVFVLSGAVFLMSASDLISIFLAIELQSYGLYIISTLYRDSEQSTSGGLTYFLIGGLASCFILLGSSLLYANSGTTSLEGIYVISSISEVYANLGESMNGEVLS* |
ORF Type | 5prime_partial |
Blastp | - |
---|---|
Blastx | NADH-ubiquinone oxidoreductase chain 2 from Podospora with 67.22% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (PoanfMp04) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (YP_009237625.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer