Protein coding transcript 33291

• Transcript: Ll_transcript_370695
• CDS coordinates: 278-607 (+)
• Peptide sequence: MSFPSNYPNSPPTVKFTSELWHPNVYPDGRVCISILHPPGDDPNGYELASERWTPVHTVESIVLSIISMLSSPNDESPANVEAAKEWRDRREDFKKKVSRCVRKSQEML*
• ORF Type: complete

Annotations of Ll_transcript_370695

• Blastp: Ubiquitin-conjugating enzyme E2 13 from Arabidopsis with 88.99% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 7 from Arabidopsis with 88.24% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (AT3G46460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454055.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;