Transcript | Ll_transcript_370686 |
---|---|
CDS coordinates | 132-500 (+) |
Peptide sequence | MTSQASLLLQKQLKDLCKNPVDGFSAGLVDETNIFEWSVTIIGPPDTLYEGGFFNAIMSFPSNYPNSPPTVKFTSELWHPNVYPDGRVCISILHPPGDDPNGYELASERWTPVHTVSKNMKP* |
ORF Type | complete |
Blastp | Ubiquitin-conjugating enzyme E2 7 from Arabidopsis with 89.17% of identity |
---|---|
Blastx | Ubiquitin-conjugating enzyme E2 7 from Arabidopsis with 89.17% of identity |
Eggnog | ubiquitin-conjugating enzyme(COG5078) |
Kegg | Link to kegg annotations (AT5G59300) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454055.1) |
Pfam | Ubiquitin-conjugating enzyme (PF00179.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer