Protein coding transcript 33309

• Transcript: Ll_transcript_372197
• CDS coordinates: 328-960 (+)
• Peptide sequence: MSFCSLKALIDATSSDSSLKEEAGVRMVALFDHEECGSDSAQGAGSPVILNALSRITNSFSSDSKLFDKGIQRSFLVSADMAHALHPNYMDKHEENHQPRLHGGLVIKLNANQRYATNAVTSFIFREIASKHNLPVQDFVVRNDMPCGSTIGPILASGLGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQEFSHLDEKITVDI*
• ORF Type: complete

Annotations of Ll_transcript_372197

• Blastp: Probable aspartyl aminopeptidase from Ricinus with 87.14% of identity
• Blastx: Probable aspartyl aminopeptidase from Ricinus with 84.38% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437158.1)
• Pfam: Aminopeptidase I zinc metalloprotease (M18) (PF02127.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;