Transcript | Ll_transcript_371257 |
---|---|
CDS coordinates | 3-917 (+) |
Peptide sequence | SILISSVIGVCIPFLGKVIPALSPEKNIFFVIKAFAAGVILSTGFIHILPDAFNDLTSPCLKAHPWADFPFTGFVAMCTSMFTLMLDAYATSYFQNSQNKITDQIQHQVITTDVENSDAHAHAHPHTHGAHGHTHAAVSSQSTDILRHRVISQVLEVGIVVHSVIIGISLGASQNPDTIKPLVVALSFHQFFEGMGLGSCITQAKLKVKTITTMALFFALTTPVGIAIGIGIGTSYNETSPTSLIVEGVFNAASSGILIYMALVDILAADFMNPRMLQNGSLQFGAYLSLLIGAGCMSLIAKWA* |
ORF Type | 5prime_partial |
Blastp | Zinc transporter 1 from Arabidopsis with 56.49% of identity |
---|---|
Blastx | Zinc transporter 3 from Arabidopsis with 54.28% of identity |
Eggnog | zinc transporter(ENOG4111GP2) |
Kegg | Link to kegg annotations (AT3G12750) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447597.1) |
Pfam | ZIP Zinc transporter (PF02535.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer