Protein coding transcript 33367

• Transcript: Ll_transcript_373277
• CDS coordinates: 213-710 (+)
• Peptide sequence: MFDRRKLTSDGVGSPIHKFEGHKAAVLCVQWSPDKSSVFGSSAEDGLLNLWDYEKIGKKIERSGKRAPPGLFFQHAGHRYEITFSLVRLNIFQSFFQPYAYDARDYVLLLLKLVFSLAIKQYFLNVSIMLPLVIVRHLFLILSLNTRHQLDSEIRNIKYKWCRTL*
• ORF Type: complete

Annotations of Ll_transcript_373277

• Blastp: WD-40 repeat-containing protein MSI4 from Arabidopsis with 76.83% of identity
• Blastx: WD-40 repeat-containing protein MSI4 from Arabidopsis with 72.28% of identity
• Eggnog: retinoblastoma binding protein(ENOG410XNU9)
• Kegg: Link to kegg annotations (AT2G19520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415490.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;