Transcript | Ll_transcript_373282 |
---|---|
CDS coordinates | 55-933 (+) |
Peptide sequence | MEISPQTTNQSDNVVMKKKETRGRKPKPKDDQQQTKKKQQHQQEHEPTVDEKYTQWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVVKPRVAAAEHICQFNEEARSPFVKKYKTIIHPGEVNRIRELPQNSKIVATHTDSPDVLIWDVESQPNRHAVLGAANSRPDLILTGHQDNAEFALAMCPTEPYVLSGGKDKSVVLWSIADHITSAADPTSGGSIIKQDSKSGEGNDKSADSPSLGPRGVYYGHDDTVEDVAFCPSR* |
ORF Type | complete |
Blastp | WD-40 repeat-containing protein MSI4 from Arabidopsis with 77.59% of identity |
---|---|
Blastx | WD-40 repeat-containing protein MSI4 from Arabidopsis with 88.52% of identity |
Eggnog | retinoblastoma binding protein(ENOG410XNU9) |
Kegg | Link to kegg annotations (AT2G19520) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415490.1) |
Pfam | Histone-binding protein RBBP4 or subunit C of CAF1 complex (PF12265.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer