Protein coding transcript 33371

• Transcript: Ll_transcript_373284
• CDS coordinates: 55-1119 (+)
• Peptide sequence: MEISPQTTNQSDNVVMKKKETRGRKPKPKDDQQQTKKKQQHQQEHEPTVDEKYTQWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVVKPRVAAAEHICQFNEEARSPFVKKYKTIIHPGEVNRIRELPQNSKIVATHTDSPDVLIWDVESQPNRHAVLGAANSRPDLILTGHQDNAEFALAMCPTEPYVLSGGKDKSVVLWSIADHITSAADPTSGGSIIKQDSKSGEGNDKSADSPSLGPRGVYYGHDDTVEDVAFCPSSAQEFCSVGDDSCLILWDARVGSSPVVKVEKAHNADLHCVDWNPHDVNLILTGYVLLLYDSYH*
• ORF Type: complete

Annotations of Ll_transcript_373284

• Blastp: WD-40 repeat-containing protein MSI4 from Arabidopsis with 79.26% of identity
• Blastx: WD-40 repeat-containing protein MSI4 from Arabidopsis with 88.55% of identity
• Eggnog: retinoblastoma binding protein(ENOG410XNU9)
• Kegg: Link to kegg annotations (AT2G19520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415490.1)
• Pfam: Histone-binding protein RBBP4 or subunit C of CAF1 complex (PF12265.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;