Protein coding transcript 334

• Transcript: Ll_transcript_441102
• CDS coordinates: 3-305 (+)
• Peptide sequence: LIIWLFVVLIINSSYTASLTSILTVQQLSSQIEGIDSLTSGIQPIGIQEGSFAKKYLIDELNIAPSRIVTLKNPDAYIDALSRGPNNGGVLAVVDELPYIE
• ORF Type: internal

Annotations of Ll_transcript_441102

• Blastp: Glutamate receptor 3.4 from Arabidopsis with 73.27% of identity
• Blastx: Glutamate receptor 3.4 from Arabidopsis with 73.27% of identity
• Eggnog: PBPe(ENOG410ZZ8P)
• Kegg: Link to kegg annotations (AT1G05200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447367.1)
• Pfam: Ligand-gated ion channel (PF00060.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;