| Transcript | Ll_transcript_371667 |
|---|---|
| CDS coordinates | 125-604 (+) |
| Peptide sequence | MVHSAYDSFELLTDCPSKIESIESYGSKILLGCSDGSLRIYAPSQPPPLSQPEELRKEPYALERCVSGFAKKPLISMQVVESRELLLSLSESIALHRLPNFEAVAVITKAKGAHVFCWDEERGFLCFARQKRVCIFRHDGNSFLPKHYYFFFGFCWTRP* |
| ORF Type | complete |
| Blastp | Vam6/Vps39-like protein from Homo with 27.7% of identity |
|---|---|
| Blastx | - |
| Eggnog | beta receptor associated protein 1(ENOG410XNSX) |
| Kegg | Link to kegg annotations (23339) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019431559.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer