Protein coding transcript 33452

• Transcript: Ll_transcript_371217
• CDS coordinates: 122-1765 (+)
• Peptide sequence: MLTANNGVRNLKANCMVLLPISKKQLCLSLLNSCSSIKQLHQIQSQIHVSDLHHDTFLLAQLIYSFSLKPFKNLNHAQKLVRFCNNPSPISWNILIRGYSTTDSPKNAIWVFDEMRKNGIKPNKLTFPFLFKSCAVEKALFEGKQVHGDAVKFGLDTDVYVGNNLVNFYGCCKKILDAKKVFDEMPDRSVVSWNSVITASVESLWFKDGIGYFLMMRDYGFEPDETTMVLLLNVCAELGYLSLGRWVHSQIVLRGMVLSVQLGTALVDMYSKSGSVGYGKLVFGRMEKRNVWTWSAMILGLAQHGFAEEALQLFAMMSHNSKGMVRSRTKDPRGGSDLSLDSVDSRSFIAPICSMENNSNICPNYVTYLGVLCACSHAGMVDEGYRYFRDMDHVHGIKPMMVHYGAMVDILGRAGLLSEAYDFVQSMPIEPDPIIWRTLLSACTVRDAQDHTGIGDKVRKKLLLLEPRRGGNLVIVANMYAEVGMWEEAANVRRNMRDGGMKKVAGESCVDLGRSMYRFFAGCDSHRDLFPVYHLLDGLNLHLKMVH*
• ORF Type: complete

Annotations of Ll_transcript_371217

• Blastp: Pentatricopeptide repeat-containing protein At2g36730 from Arabidopsis with 52.68% of identity
• Blastx: Pentatricopeptide repeat-containing protein At2g36730 from Arabidopsis with 49.91% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT2G36730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446938.1)
• Pfam: PPR repeat family (PF13041.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;