Protein coding transcript 33461

• Transcript: Ll_transcript_370811
• CDS coordinates: 162-512 (+)
• Peptide sequence: MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREDHTVGNILRMQLHRDPNVLFAGYKLPHPLQYKIIIRIHTTSQSSPMQAYNQSINDLDRELDQLKNAFEAEMTKFSRDY*
• ORF Type: complete

Annotations of Ll_transcript_370811

• Blastp: DNA-directed RNA polymerases II, IV and V subunit 11 from Arabidopsis with 84.48% of identity
• Blastx: DNA-directed RNA polymerases II, IV and V subunit 11 from Arabidopsis with 84.48% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G52090)
• CantataDB: Link to cantataDB annotations (CNT0000035)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434491.1)
• Pfam: RNA polymerase Rpb3/Rpb11 dimerisation domain (PF13656.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;