Protein coding transcript 33491

• Transcript: Ll_transcript_372556
• CDS coordinates: 27-314 (+)
• Peptide sequence: MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRHVPRRFKSGFREGTEAAPRKKGAAASA*
• ORF Type: complete

Annotations of Ll_transcript_372556

• Blastp: 60S ribosomal protein L37-3 from Arabidopsis with 90.53% of identity
• Blastx: 60S ribosomal protein L37-3 from Arabidopsis with 95.18% of identity
• Eggnog: Binds to the 23S rRNA (By similarity)(COG2126)
• Kegg: Link to kegg annotations (AT3G16080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448155.1)
• Pfam: Ribosomal protein L37e (PF01907.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;