| Transcript | Ll_transcript_371454 |
|---|---|
| CDS coordinates | 1-366 (+) |
| Peptide sequence | RGPALIGYTEIDQVSLSEISARGQPEPTGLLISGLEDLGLDHFHIGVLCLIGNCMCMAAFLAIQTPVLRKFPSNLSVTAYSYFFGTVLMVAVSLFMTHESTNWSLTQSEILAVIYAVSLQF* |
| ORF Type | 5prime_partial |
| Blastp | WAT1-related protein At4g19185 from Arabidopsis with 66.38% of identity |
|---|---|
| Blastx | WAT1-related protein At4g19185 from Arabidopsis with 66.38% of identity |
| Eggnog | Auxin-induced protein(ENOG4110YP2) |
| Kegg | Link to kegg annotations (AT4G19185) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019422403.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer