Protein coding transcript 33532

• Transcript: Ll_transcript_372060
• CDS coordinates: 3832-4455 (+)
• Peptide sequence: MNVISESVKLVMEEDPLRPLVLGGDHSISFPVVRAVSEKLGGPVDILHLDAHPDNYDAFEGNKYSHASSFARIMEGGYARRLLQVGIRSITTEGREQAKRFGAEQYEMRTFSKDRSFLENLKLGQGVKGVYISIDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHNLEGDVVAADVVEFNPQRDTVDGMTAMVAAKLVRELSAKIAK*
• ORF Type: complete

Annotations of Ll_transcript_372060

• Blastp: Arginase 1, mitochondrial from Arabidopsis with 92.27% of identity
• Blastx: Pentatricopeptide repeat-containing protein At2g22410, mitochondrial from Arabidopsis with 57.27% of identity
• Eggnog: hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines(COG0010)
• Kegg: Link to kegg annotations (AT4G08900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447172.1)
• Pfam: Arginase family (PF00491.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;