Protein coding transcript 33552

• Transcript: Ll_transcript_371564
• CDS coordinates: 1-354 (+)
• Peptide sequence: QHQLPGGHIEHNVHQGQPNPGNSFLSGIKQRLLSFIFQSIWNEERDDNLVSFLNLLHNPFFPRFIWLFTFVTDSGIFYFVLERHRHIVCFNMLVSFSFFYDASSFNFFPFILHSKSF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_371564

• Blastp: Light-mediated development protein DET1 from Arabidopsis with 50.94% of identity
• Blastx: Light-mediated development protein DET1 from Lycopersicon with 82.61% of identity
• Eggnog: de-etiolated homolog 1 (Arabidopsis)(ENOG410XSK5)
• Kegg: Link to kegg annotations (AT4G10180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444613.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;