Transcript | Ll_transcript_370752 |
---|---|
CDS coordinates | 86-592 (+) |
Peptide sequence | MEEIIKGDLVTRIQAVKQKSGKSYNQIAEETGLTNVYVAQLLRRQAQLKPETAPKLRAALPDLTEELLIQMVKPPLRSYDPNLIQDPTVYRLNEAVMHFGESIKEIINEEFGDGIMSAIDFYCSVDKVKGVDGKDRVVLTFDGKYLPYTEQKSEDMVSVSRIRPQGNQ* |
ORF Type | complete |
Blastp | Cyanate hydratase from Medicago with 83.02% of identity |
---|---|
Blastx | Cyanate hydratase from Medicago with 83.02% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (MTR_1g041795) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449957.1) |
Pfam | Cyanate lyase C-terminal domain (PF02560.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer