Protein coding transcript 33633

• Transcript: Ll_transcript_370763
• CDS coordinates: 1-621 (+)
• Peptide sequence: LLLSFMALITSQPKNPILNHFTTFHRAIPRLNKSVIGLGSFSNNAKPIKVSNFNSNSTKFSIKNNPYSPKVIAANAAFSDTFEPQKQDGPNNLKKPRKILFSDVEVTREKEVFFGRKWNTLNIATGVIVLSMHVLSLFAPFHFNWPAFSVAVSLYVVTGLFGITLSFHRNLSHKSFKVPKWLEYFFAYCGVLALQVHTILVFLING*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_370763

• Blastp: Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic from Arabidopsis with 62% of identity
• Blastx: Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic from Arabidopsis with 76.44% of identity
• Eggnog: desaturase(COG1398)
• Kegg: Link to kegg annotations (AT3G15850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456129.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;