Transcript | Ll_transcript_370764 |
---|---|
CDS coordinates | 1-759 (+) |
Peptide sequence | LLLSFMALITSQPKNPILNHFTTFHRAIPRLNKSVIGLGSFSNNAKPIKVSNFNSNSTKFSIKNNPYSPKVIAANAAFSDTFEPQKQDGPNNLKKPRKILFSDVEVTREKEVFFGRKWNTLNIATGVIVLSMHVLSLFAPFHFNWPAFSVAVSLYVVTGLFGITLSFHRNLSHKSFKVPKWLEYFFAYCGVLALQGNPIDWVSTHRYHHQFCDSERDPHTPTQGFWYSHITWLLDTNSVEQKVSYPYLIIIN* |
ORF Type | 5prime_partial |
Blastp | Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic from Arabidopsis with 64.24% of identity |
---|---|
Blastx | Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic from Arabidopsis with 64.24% of identity |
Eggnog | desaturase(COG1398) |
Kegg | Link to kegg annotations (AT3G15850) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456129.1) |
Pfam | Fatty acid desaturase (PF00487.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer