Protein coding transcript 33637

• Transcript: Ll_transcript_370801
• CDS coordinates: 2525-2914 (+)
• Peptide sequence: MAFALALQSVHDLPEGHGQTILTATTAIVVLTVLLIGGSTGTMLEALDVVGGDSHSDSPLASVGTITNYEENNGYVAPSYEEESSSGSKIKMKLKEFHRSATSFTALDKNYLTPFFTSQNGDEEDEGKF*
• ORF Type: complete

Annotations of Ll_transcript_370801

• Blastp: Sodium/hydrogen exchanger 6 from Arabidopsis with 88.73% of identity
• Blastx: Sodium/hydrogen exchanger 6 from Arabidopsis with 85.36% of identity
• Eggnog: Sodium hydrogen exchanger(COG0025)
• Kegg: Link to kegg annotations (AT1G79610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426016.1)
• Pfam: Sodium/hydrogen exchanger family (PF00999.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;