Protein coding transcript 33685

• Transcript: Ll_transcript_372935
• CDS coordinates: 60-557 (+)
• Peptide sequence: MENSKKFVEGEVIYKKSQELEDEEAFSYATQLGFSTVLSMSLQSAFELGVFDILQKAGPNAQLSANQIASQLSCNNPEAASMLDRVLALFASHDILKCSLIPLHQNLGSFQRLYSMAPVAKFFASDSDGFSLGPLMALIQDNVFLKSWLVLFCLFLITNLSPFLL*
• ORF Type: complete

Annotations of Ll_transcript_372935

• Blastp: Caffeic acid 3-O-methyltransferase 1 from Populus with 47.37% of identity
• Blastx: Caffeic acid 3-O-methyltransferase 1 from Populus with 47.37% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440464.1)
• Pfam: Dimerisation domain (PF08100.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;