Transcript | Ll_transcript_373131 |
---|---|
CDS coordinates | 260-826 (+) |
Peptide sequence | MMDTQQVQHKYELDHSNRKQELKAFDDTKAGVKGLVDAGITKIPHIFIASTTENSFKTSTSTSNELQIPVIDFKHEELQEDGVARKHIIDKVKVASETCGFFQVVNHGVPKEVLDDMIEGVRRFHEQTHDVKKEFYTRDGSRKVRYFSNFDLYESKAANWRDTMICGMAPDPPKPEELPTTCRYVCSI* |
ORF Type | complete |
Blastp | 1-aminocyclopropane-1-carboxylate oxidase homolog 1 from Arabidopsis with 53.01% of identity |
---|---|
Blastx | 1-aminocyclopropane-1-carboxylate oxidase homolog 1 from Arabidopsis with 60.54% of identity |
Eggnog | 2OGFe(II) oxygenase(COG3491) |
Kegg | Link to kegg annotations (AT1G06620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426496.1) |
Pfam | non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer