Protein coding transcript 33708

• Transcript: Ll_transcript_373118
• CDS coordinates: 276-866 (+)
• Peptide sequence: MKDGKGRTWDVMIKHYSCNKQSAFISGWINFVEDNNLKIGDVCVFVLNKCKKLSFQVVIFPFEDDSTLPKFAEQKGLSIMPSSCLEVPETPKANILVSSINHFTIYIKDGSYLTSIPMSFMRNYHTLGGKKAKLRVGKRTWDVKVQYYQTRSFARFTDGWRDFAKECNLNVGDSCRFQIIDQENFELSVSIMKHNH*
• ORF Type: complete

Annotations of Ll_transcript_373118

• Blastp: B3 domain-containing protein Os03g0620400 from Oryza sativa with 23.71% of identity
• Blastx: B3 domain-containing protein Os03g0620400 from Oryza sativa with 23.14% of identity
• Eggnog: transcription, DNA-dependent(ENOG41104G8)
• Kegg: Link to kegg annotations (4333466)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423704.1)
• Pfam: B3 DNA binding domain (PF02362.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;