Transcript | Ll_transcript_373118 |
---|---|
CDS coordinates | 276-866 (+) |
Peptide sequence | MKDGKGRTWDVMIKHYSCNKQSAFISGWINFVEDNNLKIGDVCVFVLNKCKKLSFQVVIFPFEDDSTLPKFAEQKGLSIMPSSCLEVPETPKANILVSSINHFTIYIKDGSYLTSIPMSFMRNYHTLGGKKAKLRVGKRTWDVKVQYYQTRSFARFTDGWRDFAKECNLNVGDSCRFQIIDQENFELSVSIMKHNH* |
ORF Type | complete |
Blastp | B3 domain-containing protein Os03g0620400 from Oryza sativa with 23.71% of identity |
---|---|
Blastx | B3 domain-containing protein Os03g0620400 from Oryza sativa with 23.14% of identity |
Eggnog | transcription, DNA-dependent(ENOG41104G8) |
Kegg | Link to kegg annotations (4333466) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423704.1) |
Pfam | B3 DNA binding domain (PF02362.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer