Transcript | Ll_transcript_371322 |
---|---|
CDS coordinates | 750-1103 (+) |
Peptide sequence | MLTNMLSVVKFMKLLDKYIFLSVSWFAGSAESRRGTILFLHGAPTQSFSYRVVMSQLGDAGFHCFAPDWIGFGFSDKPQPGYGFNYTEKEFHDALDNLLDVLRVESPLFLVVQVSKA* |
ORF Type | complete |
Blastp | Haloalkane dehalogenase from Mycobacterium avium complex (MAC) with 57.14% of identity |
---|---|
Blastx | Haloalkane dehalogenase 2 from Mycobacterium tuberculosis complex with 40.62% of identity |
Eggnog | Alpha beta hydrolase(ENOG410XQGI) |
Kegg | Link to kegg annotations (MAP_2057) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454482.1) |
Pfam | Serine aminopeptidase, S33 (PF12146.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer