Protein coding transcript 33981

• Transcript: Ll_transcript_372437
• CDS coordinates: 144-569 (+)
• Peptide sequence: MLASGSDDGTISIRDLRLLKEGDSVVAHFEYHKHPITSIEWSPHEASSLAVSSSDNQLTIWDLSLEKDEEEEAEFKAKTKEEVNAPQDLPPQLLFIHQGQKDLKELHWHTQIPGMIVSTASDGFNILMPSNIQSTLPSDGA*
• ORF Type: complete

Annotations of Ll_transcript_372437

• Blastp: Glutamate-rich WD repeat-containing protein 1 from Dictyostelium with 53.44% of identity
• Blastx: Glutamate-rich WD repeat-containing protein 1 from Dictyostelium with 52.11% of identity
• Eggnog: Glutamate-rich wd repeat-containing protein(ENOG410XPDB)
• Kegg: Link to kegg annotations (DDB_G0291566)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463902.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;