Transcript | Ll_transcript_441112 |
---|---|
CDS coordinates | 3-857 (+) |
Peptide sequence | TTFRGKCNNKAISITIHGTLVAPYDYRVIGDAGYWLTFDHVSGVAIHGGVLDGQGSSLWECKNSDTKVNCPTGATSLAFNNSDHIVVTGLKSVNSQLFHIIVMGSHNVKVHGVKLIAPGNSPNTDGIHIQFSSHVTILKPRIHTGDDCISIGPGTNNLWIEDVACGPGHGISIGSLGWYLNEPGVKNVTVRRAKFSKTQNGFRIKSWGRASNGFVNDIHFEHALMTHVQNPIVIDQNYCPFLDGCPSEVSLKHYEVLRSVYLASPSEIKAWFLRIILAITLHYIW |
ORF Type | internal |
Blastp | Polygalacturonase from Prunus with 62.5% of identity |
---|---|
Blastx | Polygalacturonase from Prunus with 62.5% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439106.1) |
Pfam | Glycosyl hydrolases family 28 (PF00295.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer