Protein coding transcript 34082

• Transcript: Ll_transcript_372168
• CDS coordinates: 140-469 (+)
• Peptide sequence: MGMNIIQLKELTPDEPKVLTLNLLKTMDPNDPENVKPRGQLTVEVLYNPFKADELPENAEDGNPIEKAPDGTPAGGGLLVVIIHEAEDVEGKHHTNPYARLTFKGEERKT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_372168

• Blastp: Synaptotagmin-2 from Arabidopsis with 67.27% of identity
• Blastx: Synaptotagmin-2 from Arabidopsis with 68.1% of identity
• Eggnog: Domain-Containing protein(COG5038)
• Kegg: Link to kegg annotations (AT1G20080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003545028.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;